New footage emerges of Ederson appearing to be out cold before angrily storming off when substituted by Pep Guardiola during Man City's 2-0 win over Tottenham from how to remove password on memory card with nokia mobileere mere janet geownload bhoot fm normal quality Watch Video

Preview(s):

Play Video:
(Note: The default playback of the video is HD VERSION. If your browser is buffering the video slowly, please play the REGULAR MP4 VERSION or Open The Video below for better experience. Thank you!)
⏲ Duration: 1:1
👁 View: 35K times
✓ Published: 17-May-2024
Open HD Video
Open MP4 Video
Download HD Video
Download MP4 Video
Description:
New footage has emerged showing Manchester City goalkeeper Ederson appearing to be out cold following a collision with Tottenham's Cristian Romero before being substituted by Pep Guardiola during Man City's 2-0 win on Tuesday night. The incident occurred in the second half, and despite initial attempts to continue playing, Ederson was eventually withdrawn from the match.<br/><br/>The footage, shared on social media platform X (formerly known as Twitter), shows Ederson lying on the ground, seemingly unconscious, as players from both teams urgently signaled for medical assistance. Despite appearing groggy when he returned to his feet, Ederson was allowed to play on for several minutes before Guardiola decided to replace him with backup goalkeeper Stefan Ortega. This decision led to a visibly frustrated Ederson storming off the pitch.<br/><br/>Pep Guardiola later defended the club's handling of the situation, insisting that Ederson did not suffer a concussion but rather an eye injury from the collision, which saw Romero receive a booking. However, leading brain injury association Headway criticized Man City's response, arguing that the player's condition warranted immediate substitution under concussion protocols.<br/><br/>Headway's chief executive, Luke Griggs, emphasized the principle of \

Share with your friends:

Whatsapp | Viber | Telegram | Line | SMS
Email | Twitter | Reddit | Tumblr | Pinterest

Related Videos

Premier League clubs are set to vote on removing VAR, so could we finally see an end to managers moaning?
⏲ 1:47 👁 30K
Florida Governor Ron DeSantis signed a bill making climate change a lesser state priority in Florida. The bill removes the word &#92;
⏲ 0:41 👁 360K
A former guide dog has undergone a £5k operation to prevent her going blind.&#60;br/&#62;&#60;br/&#62;Alice, a 14-year-old Labrador Retriever cross, had a four-hour procedure to remove ulcers on her eyes. &#60;br/&#62;&#60;br/&#62;Owner Michelle Earl, 52, took in Alice after her career as a guide dog came to an end five years ago following her previous owner&#39;s death.&#60;br/&#62;&#60;br/&#62;Michelle, a nanny, from Sevenoaks, Kent, said: &#92;
⏲ 2:3 👁 290K
How to replace Hard Disk in Your Dell LATITUDE E6430&#60;br/&#62;Welcome to our comprehensive guide on replacing the hard disk in your Dell (Latitude E6430)laptop! Whether you&#39;re upgrading to a larger storage capacity or need to replace a failing drive, this step-by-step tutorial will walk you through the entire process.&#60;br/&#62;&#60;br/&#62;In this video, we&#39;ll cover everything you need to know, from preparing your workspace and gathering the necessary tools to safely removing the old hard disk and installing the new one. We&#39;ll also provide tips on data backup and transferring your files to ensure a smooth transition.&#60;br/&#62;&#60;br/&#62;No prior technical experience is required, as we&#39;ll explain each step in detail and provide clear demonstrations. By following along with our instructions, you&#39;ll be able to upgrade or replace the hard disk in your Dell laptop with confidence.&#60;br/&#62;&#60;br/&#62;Don&#39;t let a full or failing hard drive slow you down – join us and learn how to give your Dell laptop a storage boost today!&#60;br/&#62;&#60;br/&#62;&#92;
⏲ 2:5 👁 30K
Dating app Bumble faced backlash for a billboard ad campaign that seemingly shamed women for not being sexually active and mocked celibacy. Bumble apologized, saying the ads were meant to appeal to those frustrated by modern dating but instead did the opposite. The company will remove the ads and donate the billboard space to organizations supporting women, including the National Domestic Violence Hotline. This follows Bumble&#39;s announcing layoffs in February and its stock price falling 45% since last July as young adults opt for in-person or social media connections over dating apps.
⏲ 0:37 👁 425K
#DilKaKyaKareinEpisode2 #sadiakhan #imranabbas&#60;br/&#62;Dil Ka Kya Karein Episode 2 &#124; Imran Abbas &#124; Sadia Khan &#124; Mirza Zain Baig [ENG CC] Green TV&#60;br/&#62;&#60;br/&#62;A Sweet and Sour Love Story with a Tinge of Filmy Drama&#60;br/&#62;where a superstar&#39;s life takes an unexpected turn when he falls for his die-hard fan, Sherry. Sherry, a bubbly, happy-go-lucky girl, brings a breath of fresh air into the actor&#39;s otherwise scripted existence. Their love story, set against the backdrop of fame and fortune, seems like a fairytale, brimming with sweet moments and cinematic romance.&#60;br/&#62;However, the story takes a tragic twist, far removed from the reels of film. The superstar, accustomed to adulation and yes-men, finds himself facing an unfamiliar and harsh reality when Sherry rejects him. Despite their magical beginning and the undeniable chemistry, Sherry&#39;s refusal shatters the actor&#39;s heart, plunging him into a world of emotional turmoil.&#60;br/&#62;The superstar&#39;s journey, from the heights of stardom to the depths of rejection, underscores the raw and often untold side of celebrity life, making this story both sweet and sour, with a powerful touch of real-life drama.&#60;br/&#62;&#60;br/&#62;Presented by: Watermark Films&#60;br/&#62;Written by: Edison Idrees&#60;br/&#62;Directed by: Fahim Burney&#60;br/&#62;&#60;br/&#62;Cast&#60;br/&#62;Imran Abbas(Aryan Khan)&#60;br/&#62;Sadia Khan(Sheharbano)&#60;br/&#62;Mirza Zain Baig(Nayal)&#60;br/&#62;Esha Salman&#60;br/&#62;Noman Kahout&#60;br/&#62;Rabita Ali&#60;br/&#62;Roma Michael&#60;br/&#62;Saba Hameed&#60;br/&#62;Shaheen Khan&#60;br/&#62;Semi Pasha&#60;br/&#62;Nadia Hussain&#60;br/&#62;Sajid Hassan&#60;br/&#62;Syed Afzal Ali&#60;br/&#62;Humaira Bano&#60;br/&#62;Farida Rais&#60;br/&#62;Mehboob Sultan&#60;br/&#62;Komal Khan&#60;br/&#62;Falak Butt&#60;br/&#62;Uzma Ali Khan&#60;br/&#62;&#60;br/&#62;#DilKaKyaKareinEpisode2 #sadiakhan#imranabbas#mirzazainbaig#sabahameed #RabitaAli #nadiahussain &#60;br/&#62;
⏲ 36:11 👁 60K
Here&#39;s what happened: In Indonesia, a ground handling worker was at the L1 passenger door of a TransNusa Airbus A320-214 (PK-TLB). Due to a lack of proper coordination, the step ladder was removed while the worker was still on the plane, causing him to fall from the door area.&#60;br/&#62;&#60;br/&#62; #airport #airportaccident #aviation
⏲ 0:7 👁 25K
डिटैन फेस पैक कब लगाएं: फेस पैक हम सभी लगाते हैं। ये स्किन की कई समस्याओं को दूर करने और चेहरे की चमक बरकरार रखने में मददगार है। लोग अपनी अलग-अलग स्किन के अनुसार, अलग-अलग प्रकार से फेस पैक का इस्तेमाल करते हैं। लेकिन, ज्यादातर लोग ये नहीं जानते कि डिटैन फेस पैक कब और कितने दिनों के अंतराल पर लगाना चाहिए। तो, आइए हम आपको बताते हैं इस बारे में। इस दौरान हम ये भी जानेंगे कि अपनी स्किन के अनुसार हम डिटैन फेस पैक का इस्तेमाल कर सकते हैं।&#60;br/&#62; &#60;br/&#62;When to apply face pack: We all apply face pack. It is helpful in removing many skin problems and maintaining the glow of the face. People use face packs in different ways according to their different skin types. But, most of the people do not know when and at what interval of how many days the face pack should be applied. So, let us tell you about this. During this, we will also know which face pack we can use according to our skin.Watch Detan Face Pack Hafte Me Kitni Bar Chehre Par Lagana Chahiye ? &#60;br/&#62; &#60;br/&#62;#detanfacepackkitnedinmelaganachahiye #detanfacepackhaftemekitnibarlagaye #detanfacepackforskintypes &#60;br/&#62;&#60;br/&#62;~PR.111~ED.118~
⏲ 1:48 👁 105K

Related Video Searches

Back to Search

«Back to how to remove password on memory card with nokia mobileere mere janet geownload bhoot fm normal quality Videos

Search Videos

Recent Searches

x8pach6 | shane indias | nass el ghiwane mahmoud essaadi | www criket video com | niwa nz | افشای سازندگان پهپاد جمهوری اسلامی آرش آرامش | indian bangla movies valobasha valobasha | www vlbdo bata com | বুকের ভিতর শূন্য খাচা একটা পোষা পাখি | sunny leone porn বৌদির video 2gp download kolkata new sabnur photos video d নাইকাদের ছবিদেশের অপুরচ§ | ynixcuwn3g4 | বাসোরাত | data gari tumi amar | manor park surgery slough | new bideo bangla ডাইরেক enlash দেশের ভিডিও সুদু কলেজের দেখতে india video com com এর ভিডির নত | বোয়ালমারী মহীলা কলেজের ছাএী ত | mona lisa fake in | aston martin dbs superleggera review | hot movir video | www sana khan photos comuchi hot tomato sauce tvc | chaplin the great dictator film | dave renton on fascism | inspitor vijay full movie download in hindi dubbed | x8pfcij | nt gwmazqvi | bangla movie song rater gayaymensingh | hothungamavideos2019 | yaar na mila | scary jeff the killer videos | uebert angel jr age | rabbit sxa wed since full | রচনা ব্যানার্জী দেব ও কোয়েল মল্লিকের গল্পাহির চাসিনা ল | india video nokia saint | messiah community church silverton ohio | domain hindi ep patrick com | মেয়েদের সুনা থেকে রক্ত বের হওয়ার | cex converter | bangla polo video com | bangladesh drugs girl | jgdress | indian bangla tv serial icca natok tuba bangladeshi new | jaat album 67 songs download | sumon new gan | mare ishq karde dewar movie | leaked video of pooja 16 বছযের ভিডিও | vikram vedha telugu movie download | makeup man malaya | yiwdry1bn1q | c3a0c2a7c2a70 banaya aapne video song download 3gp | www katrina kaif নায়িকা দের ছবিভিনেত্রী শ্রাবন্তীর ¦ | morena mia | taking dialysis at home | dr m padma sushant case | telugu uma anty short film | vdm149500462 | vdm249852314 | wwe sur | whatsapp video call on pc download | inda imagesdesh new naika boby | پیش پرده فیلم قدیمی قفس | কাজের মেয়ে টাকা চুরি করতে গিয়ে ধরা পরার পর মালিক তার টিপে টাকা বের করে নেয় |